PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038874.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 958aa    MW: 107958 Da    PI: 8.0971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038874.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.21e-09427472146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+ Ed+ l+  v++ G ++W  Ia  +g++Rt+ qc  r+q 
      Pbr038874.1 427 RKSWTAKEDKNLLYFVQEKGINNWFDIAVSLGTNRTPFQCLARYQR 472
                      789*****************************************96 PP

2Myb_DNA-binding42.71.3e-13481524246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT++Ed +l  av+ lG g+W ++a+ +g gR + qc +rw k
      Pbr038874.1 481 REWTKDEDAKLRSAVETLGEGNWQAVASALG-GRAGTQCSNRWKK 524
                      68*****************************.***********98 PP

3Myb_DNA-binding44.83e-14534577246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      grWT+eEd++l+ a  ++G+++W++ a+ ++ gRt  qc++r+ +
      Pbr038874.1 534 GRWTPEEDKRLKVAQMLFGPKNWNKTAQFVP-GRTQSQCRDRYVN 577
                      8******************************.***********77 PP

4Myb_DNA-binding40.65.8e-13586625243
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      g WT+eEd +l  a++++G   W+++a++++ +Rt+++c  r
      Pbr038874.1 586 GEWTEEEDSRLRAAIEEHGYC-WSKVAACVP-RRTDNMCWRR 625
                      68*****************99.*********.*******666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.04322421IPR017877Myb-like domain
SMARTSM007171.4E-4326423IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-11329345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-11394434IPR009057Homeodomain-like
SuperFamilySSF466892.82E-16403471IPR009057Homeodomain-like
PROSITE profilePS500909.466422474IPR017877Myb-like domain
SMARTSM007171.9E-9426476IPR001005SANT/Myb domain
PfamPF002491.4E-7427472IPR001005SANT/Myb domain
CDDcd001674.63E-7429474No hitNo description
Gene3DG3DSA:1.10.10.601.8E-12435481IPR009057Homeodomain-like
SuperFamilySSF466894.59E-19459532IPR009057Homeodomain-like
PROSITE profilePS5129421.088475530IPR017930Myb domain
SMARTSM007176.8E-13479528IPR001005SANT/Myb domain
PfamPF002499.2E-13481524IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-16482533IPR009057Homeodomain-like
CDDcd001671.82E-10482526No hitNo description
SuperFamilySSF466894.75E-23531625IPR009057Homeodomain-like
PROSITE profilePS5129410.066531579IPR017930Myb domain
SMARTSM007172.2E-12532581IPR001005SANT/Myb domain
PfamPF002493.9E-13534577IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-19534584IPR009057Homeodomain-like
CDDcd001677.72E-11535579No hitNo description
PROSITE profilePS5129418.341580634IPR017930Myb domain
SMARTSM007174.8E-11584632IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-15585625IPR009057Homeodomain-like
PfamPF002493.1E-11586625IPR001005SANT/Myb domain
CDDcd001673.53E-9587629No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 958 aa     Download sequence    Send to blast
MSPPSDDDQD QFSVDEEEED DDLFEADMEA LRRGRMLTGT SPDDLKNDGG GGNDDERQAS  60
ADSESDSDAD DDDLELLRQI RSRFSNSSDA CEPLSLKPLC TLPPDASGDE EDDYQTLLAI  120
RKRFSAYGND TLENDTKQVG SCCKSVKETC DEISAIRNDA LERFPDPEDA DLATNPLSDN  180
AEGQSSALIV WNQSDSCSTS MLPRKDSSFP KAAQVFMDAI KKNRASQKFI RNKLIQIEAK  240
IEENRKLKER VKILKDFQVS CKRRTWESLS QKKDPRVQLI LPKGPRDSRD SKVHDKKISA  300
LLYGPEENSH VANYRMTMKK YLDSLYRKKW SKVEREALEK GIKQQFQEML LQSSVDESSF  360
SERPCGESNH IDDILASIKS LEITPEMIRE FLPKVKWEQV ASMYLPGRSG AECETRWLNW  420
EDPLINRKSW TAKEDKNLLY FVQEKGINNW FDIAVSLGTN RTPFQCLARY QRSLNASILK  480
REWTKDEDAK LRSAVETLGE GNWQAVASAL GGRAGTQCSN RWKKSLHPTK KREGRWTPEE  540
DKRLKVAQML FGPKNWNKTA QFVPGRTQSQ CRDRYVNSLE PSLNYGEWTE EEDSRLRAAI  600
EEHGYCWSKV AACVPRRTDN MCWRRCKVLY PEEVLLLKEQ KKIKKRPALG PNDFLPAIDT  660
TTKTLTYPKK QNGKLSKVPN KTRPRRNKNN SESCSDAHGI DNSHQVETSN GHDVPNKKNN  720
VRKQRRRRRK STEPTGGGQV IVPVPDEHVT HKEEQRETSC SDQIVGTSDG DDTTLAVFQR  780
NKSKKRNLGP PSNDTRKKRK LVVSDCSVQD SPANNIQKGA GSHPEAAIMV CESEQGGLKL  840
DSEPNVAFQE PVIKVAGVSP KSDHDADDIL ASLGKKKSKK RRPQTSKRSP QACPPSSATM  900
KSESLPKGVG LGKGEGLDHC EPVSEIGNNR AEGDHEDGDM TLACFLRNKS KRRRQCG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-273996204155MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-273996204155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1721729RKQRRRRRK
2783799KKRNLGPPSNDTRKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009360099.10.0PREDICTED: uncharacterized protein LOC103950593
TrEMBLM5WEG40.0M5WEG4_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1